PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016501061.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 245aa    MW: 28127.4 Da    PI: 6.8813
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016501061.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.6e-14107151347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ +  ++G+g+W+ I+++m   Rt+ q+ s+ qky
   XP_016501061.1 107 PWTEEEHRRFLMGLDKYGKGDWRNISKKMVISRTPTQVASHAQKY 151
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.07E-111063IPR009057Homeodomain-like
PROSITE profilePS512936.731368IPR017884SANT domain
SMARTSM007171.4E-81466IPR001005SANT/Myb domain
CDDcd001674.73E-71863No hitNo description
Gene3DG3DSA:1.10.10.601.1E-1298156IPR009057Homeodomain-like
PROSITE profilePS5129421.106100156IPR017930Myb domain
SuperFamilySSF466892.01E-16101155IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-18103155IPR006447Myb domain, plants
SMARTSM007174.7E-12104154IPR001005SANT/Myb domain
PfamPF002491.7E-12107151IPR001005SANT/Myb domain
CDDcd001679.87E-10107151No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
METIFPTSSS WMNKSSIWTK EENKLFESAI AIYDENTPNR WFQVADMIPG KSVLDVMMQY  60
QELAADVCDI EAGLVPNPGY FASSDCGLQT FRKRGRSSDQ ERKKGVPWTE EEHRRFLMGL  120
DKYGKGDWRN ISKKMVISRT PTQVASHAQK YYQRQLSGCK DKRRPSIHDI TTFHFVADDT  180
SQNNINSLSK EKLHKFTTTT DVVKYWNSSS DEHLMDFGSS YGSSIVAYPY ELSSQSWDGH  240
GAIWD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
191103RKRGRSSDQERKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766549.10.0PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016501061.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H78e-76DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM1BUZ61e-128M1BUZ6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000534331e-128(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45824140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11280.21e-81MYB family protein